ExactAntigen

PTPRN Antibody | Novus Biologicals antibody product information
request information:
Catalog Code:H00005798-B02
Product Name:PTPRN Antibody
Product Description:Mouse Polyclonal anti-PTPRN - protein tyrosine phosphatase, receptor type, N, MaxPab Antibody
Clonality:Polyclonal
ListPrice:295
Gene ID:5798
Gene Symbol:PTPRN
Immunogen:PTPRN (AAH70053, 1 a.a. ~ 950 a.a) full-length human protein.
Epitope:MRRPRRPGGLGGSGGLRLLLCLLLLSSRPGGCSAVSAHGCLFDRRLCSHLEVCIQDGLFGQCQVGVGQARPLLQVTSPV
LQRLQGVLRQLMSQGLSWHDDLTQYVISQEMERIPRLRPPEPRPRDRSGLAPKRPGPAGELLLQDIPTGSAPAAQHRLP
QPPVGKGGAGASSSLSPLQAELLPPLLEHLLLPPQPPHPSLSYEPALLQPYLFHQFGSRDGSRVSEGSPGMVSVGPLPK
AEAPALFSRTASKGIFGD
Cross Reactivity:Human.
Packaging:0.05 ml of mouse antisera with 50% glycerol.
Uses:Antibody Reactive Against Immunizing Recombinant Protein or Transfected Lysate on ELISA and Western Blot.
Background:The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and a single catalytic domain, and thus represents a receptor-type PTP. This PTP was found to be an autoantigen that is reactive with insulin-dependent diabetes mellitus (IDDM) patient sera, and thus may be a potential target of autoimmunity in diabetes mellitus.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Host Name:Mouse
Application Summary:Western Blot, ELISA
Species Summary:Hu
Alternate Names:anti-IA-2 antibody, anti-IA-2/PTP antibody, anti-IA2 antibody, anti-ICA512 antibody, anti-R-PTP-N antibody
Package Size:0.05 ml
Preservative:No Preservative
order or
more information
:
company product webpage
Also see:
all human IA 2 antibodies


2008©ExactAntigen home | browse | about