| request information: |
|
| Catalog Code: | H00005797-A01 |
| Product Name: | PTPRM Antibody |
| Product Description: | Mouse Polyclonal anti-PTPRM |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 5797 |
| Gene Symbol: | PTPRM |
| Omim ID: | 176888 |
| Immunogen: | PTPRM (NP_002836, 381 a.a. ~ 480 a.a) partial recombinant protein with GST tag. |
| Epitope: | RGPRKLEVVEVKSRQITIRWEPFGYNVTRCHSYNLTVHYCYQVGGQEQVREEVSWDTENSHPQHTITNLSPYTNVSVKL
ILMNPEGRKESQELIVQTDE* |
| Specificity: | PTPRM - protein tyrosine phosphatase, receptor type, M |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and two tandem catalytic domains, and thus represents a receptor-type PTP. The extracellular region contains a meprin-A5 antigen-PTP mu (MAM) domain, an Ig-like domain and four fibronectin type III-like repeats. This PTP has been shown to mediate cell-cell aggregation through the interaction with another molecule of this PTP on an adjacent cell. This PTP can interact with scaffolding protein RACK1/GNB2L1, which may be necessary for the downstream signaling in response to cell-cell adhesion. Alternative splicing results in multiple transcripts encoding distinct isoforms. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-PTPRL1 antibody, anti-R-PTP-MU antibody, anti-RPTPM antibody, anti-RPTPU antibody, anti-hR-PTPu antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |