| request information: |
|
| Catalog Code: | H00005791-M04 |
| Product Name: | PTPRE Antibody |
| Product Description: | Mouse Monoclonal anti-PTPRE (2D10) |
| Clone: | 2D10 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 5791 |
| Gene Symbol: | PTPRE |
| Omim ID: | 600926, |
| Immunogen: | PTPRE (AAH50062, 511 a.a. ~ 601 a.a) partial recombinant protein with GST tag. |
| Epitope: | WRMIWEWKSHTIVMLTEVQEREQDKCYQYWPTEGSVTHGEITIEIKNDTLSEAISIRDFLVTLNQPQARQEEQVRVVRQ
FHFHGWPEIGI* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Background: | The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. Two alternatively spliced transcript variants of this gene have been reported, one of which encodes a receptor-type PTP that possesses a short extracellular domain, a single transmembrane region, and two tandem intracytoplasmic catalytic domains; Another one encodes a PTP that contains a distinct hydrophilic N-terminus, and thus represents a nonreceptor-type isoform of this PTP. Studies of the similar gene in mice suggested the regulatory roles of this PTP in RAS related signal transduction pathways, cytokines induced SATA signaling, as well as the activation of voltage-gated K+ channels. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA |
| Species Summary: | Hu |
| Alternate Names: | anti-DKFZp313F1310 antibody, anti-HPTPE antibody, anti-PTPE antibody, anti-R-PTP-EPSILON antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |