| request information: |
|
| Catalog Code: | H00005783-A01 |
| Product Name: | PTPN13 Antibody |
| Product Description: | Mouse Polyclonal anti-PTPN13 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 5783 |
| Gene Symbol: | PTPN13 |
| Omim ID: | 600267 |
| Immunogen: | PTPN13 (NP_006255, 66 a.a. ~ 176 a.a) partial recombinant protein with GST tag. |
| Epitope: | FTDENISNQDLRAFTAPEVLQNQSLTSLSDVEKIHIYSLGMTLYWGADYEVPQSQPIKLGDHLNSILLGMCEDVIYARV
SVRTVLDACSAHIRNSNCAPSFSYVKHLVKL* |
| Specificity: | PTPN13 - protein tyrosine phosphatase, non-receptor type 13 (APO-1/CD95 (Fas)-associated phosphatase) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to ELISA on the immunizing protein. |
| Background: | The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP is a large protein that possesses a PTP domain at C-terminus, and multiple noncatalytic domains, which include a domain with similarity to band 4.1 superfamily of cytoskeletal-associated proteins, a region consisting of five PDZ domains, and a leucine zipper motif. This PTP was found to interact with, and dephosphorylate Fas receptor, as well as IkappaBalpha through the PDZ domains, which suggested its role in Fas mediated programmed cell death. This PTP was also shown to interact with GTPase-activating protein, and thus may function as a regulator of Rho signaling pathway. Four alternatively spliced transcript variants, which encode distinct proteins, have been reported. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, |
| Species Summary: | Hu |
| Alternate Names: | anti-DKFZp686J1497 antibody, anti-FAP-1 antibody, anti-PNP1 antibody, anti-PTP-BAS antibody, anti-PTP-BL antibody, anti-PTP1E antibody, anti-PTPL1 antibody, anti-PTPLE antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |
|