ExactAntigen

Mouse Polyclonal anti-PTPN11 - protein tyrosine phosphatase, non-receptor type 11 (Noonan syndrome 1), MaxPab Antibody | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00005781-B02
ProductName: PTPN11 Antibody
Product Description: Mouse Polyclonal anti-PTPN11 - protein tyrosine phosphatase, non-receptor type 11 (Noonan syndrome 1), MaxPab Antibody
Clonality: Polyclonal
Immunogen: PTPN11 (AAH08692, 1 a.a. ~ 460 a.a) full-length human protein.
Epitope: MTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTGDYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSGKEAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGESNDGKSKVTHVMIRCQELKYDVGGGERFDSLTDLVEHYKKNPMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKLAETTDKVKQGFWEEFETLQ ...
CrossReactivity: Human. Other species not tested.
Packaging: 0.05 ml of mouse antisera with 50% glycerol.
Uses: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Background: The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains two tandem Src homology-2 domains, which function as phospho-tyrosine binding domains and mediate the interaction of this PTP with its substrates. This PTP is widely expressed in most tissues and plays a regulatory role in various cell signaling events that are important for a diversity of cell functions, such as mitogenic activation, metabolic control, transcription regulation, and cell migration. Mutations in this gene are a cause of Noonan syndrome as well as acute myeloid leukemia.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Host_Name: Mouse
ListPrice: 295
AppSummary: WB, ELISA
SpeciesSummary: Hu
ALTnames: anti-BPTP3 antibody, anti-CFC antibody, anti-MGC14433 antibody, anti-NS1 antibody, anti-PTP-1D antibody, anti-PTP2C antibody, anti-SH-PTP2 antibody, anti-SH-PTP3 antibody, anti-SHP2 antibody
ProteinTarget: protein tyrosine phosphatase, non-receptor type 11 (Noonan syndrome 1)
PackageSize: 0.05 ml
NotesMain: This antibody is available only in North America and is supplied by Abnova. Lead time may be 10-14 days. The immunizing protein may also available for this product. Unit cost for the protein is $250 (2 ug), $305 (10 ug), and $445 (25 ug). MaxPab is a registered trademark of Abnova.
Gene_Id: 5781
Gene_Symbol: PTPN11
more information: company product webpage
Also see:
see all human PTPN11 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about