| CatalogCode: | | H00005781-B02 |
| ProductName: | | PTPN11 Antibody |
| Product Description: | | Mouse Polyclonal anti-PTPN11 - protein tyrosine phosphatase, non-receptor type 11 (Noonan syndrome 1), MaxPab Antibody |
| Clonality: | | Polyclonal |
| Immunogen: | | PTPN11 (AAH08692, 1 a.a. ~ 460 a.a) full-length human protein. |
| Epitope: | | MTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTGDYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSGKEAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGESNDGKSKVTHVMIRCQELKYDVGGGERFDSLTDLVEHYKKNPMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKLAETTDKVKQGFWEEFETLQ ... |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | | The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains two tandem Src homology-2 domains, which function as phospho-tyrosine binding domains and mediate the interaction of this PTP with its substrates. This PTP is widely expressed in most tissues and plays a regulatory role in various cell signaling events that are important for a diversity of cell functions, such as mitogenic activation, metabolic control, transcription regulation, and cell migration. Mutations in this gene are a cause of Noonan syndrome as well as acute myeloid leukemia. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host_Name: | | Mouse |
| ListPrice: | | 295 |
| AppSummary: | | WB, ELISA |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-BPTP3 antibody, anti-CFC antibody, anti-MGC14433 antibody, anti-NS1 antibody, anti-PTP-1D antibody, anti-PTP2C antibody, anti-SH-PTP2 antibody, anti-SH-PTP3 antibody, anti-SHP2 antibody |
| ProteinTarget: | | protein tyrosine phosphatase, non-receptor type 11 (Noonan syndrome 1) |
| PackageSize: | | 0.05 ml |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova. Lead time may be 10-14 days. The immunizing protein may also available for this product. Unit cost for the protein is $250 (2 ug), $305 (10 ug), and $445 (25 ug). MaxPab is a registered trademark of Abnova. |
| Gene_Id: | | 5781 |
| Gene_Symbol: | | PTPN11 |
| more information: | | company product webpage |