| request information: |
|
| Catalog Code: | H00005743-B01 |
| Product Name: | PTGS2 Antibody |
| Product Description: | Mouse Polyclonal anti-PTGS2 - prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase and cyclooxygenase), MaxPab Antibody |
| Clonality: | Polyclonal |
| ListPrice: | 295 |
| Gene ID: | 5743 |
| Gene Symbol: | PTGS2 |
| Immunogen: | PTGS2 (1 a.a. ~ 604 a.a) full-length human protein. |
| Epitope: | MLARALLLCAVLALSHTANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFLTRIKLFLKPTPNTVHYILT
HFKGFWNVVNNIPFLRNAIMSYVLTSRSHLIDSPPTYNADYGYKSWEAFSNLSYYTRALPPVPDDCPTPLGVKGKKQLP
DSNEIVEKLLLRRKFIPDPQGSNMMFAFFAQHFTHQFFKTDHKRGPAFTNGLGHGVDLNHIYGETLARQRKLRLFKDGK
MKYQIIDGEMYPPTVKDT |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody reactive against transfected lysate for Western Blot. Has also been used for immunofluoresence and ELISA. |
| Background: | Prostaglandin-endoperoxide synthase (PTGS), also known as cyclooxygenase, is the key enzyme in prostaglandin biosynthesis, and acts both as a dioxygenase and as a peroxidase. There are two isozymes of PTGS: a constitutive PTGS1 and an inducible PTGS2, which differ in their regulation of expression and tissue distribution. This gene encodes PTGS2, which shows 86% - 89% amino acid sequence identity with mouse, rat, sheep, bovine, horse and rabit PTGS2 proteins, respectively. Human PTGS2 is expressed in a limited number of cell types and regulated by specific stimulatory events, suggesting that it is responsible for the prostanoid biosynthesis involved in inflammation and mitogenesis. The expression of this gene is deregulated in epithelial tumors. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | ELISA, immunofluorescence, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-COX-2 antibody, anti-COX2 antibody, anti-PGG/HS antibody, anti-PGHS-2 antibody, anti-PHS-2 antibody, anti-hCox-2 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No Preservative |
order or
more information: | company product webpage |