| request information: |
|
| Catalog Code: | H00005734-A01 |
| Product Name: | PTGER4 Antibody |
| Product Description: | Mouse Polyclonal anti-PTGER4 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 5734 |
| Gene Symbol: | PTGER4 |
| Omim ID: | 601586, |
| Immunogen: | PTGER4 (NP_000949, 379 a.a. ~ 489 a.a) partial recombinant protein with GST tag. |
| Epitope: | SFISRELKEISSTSQTLLPDLSLPDLSENGLGGRNLLPGVPGMGLAQEDTTSLRTLRISETSDSSQGQDSESVLLVDEA
GGSGRAGPAPKGSSLQVTFPSETLNLSEKCI* |
| Specificity: | PTGER4 - prostaglandin E receptor 4 (subtype EP4) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | The protein encoded by this gene is a member of the G-protein coupled receptor family. This protein is one of four receptors identified for prostaglandin E2 (PGE2). This receptor can activate T-cell factor signaling. It has been shown to mediate PGE2 induced expression of early growth response 1 (EGR1), regulate the level and stability of cyclooxygenase-2 mRNA, and lead to the phosphorylation of glycogen synthase kinase-3. Knockout studies in mice suggest that this receptor may be involved in the neonatal adaptation of circulatory system, osteoporosis, as well as initiation of skin immune responses. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-EP4 antibody, anti-EP4R antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |