ExactAntigen

Mouse Monoclonal anti-PTEN (2G9) | Novus Biologicals antibody product information
CatalogCode:H00005728-M01
ProductName:PTEN Antibody
Product Description:Mouse Monoclonal anti-PTEN (2G9)
Clone:2G9
Clonality:Monoclonal
Immunogen:PTEN (AAH05821, 221 a.a. ~ 320 a.a) partial recombinant protein with GST tag.
Epitope:KVKIYSSNSGPTRREDKFMYFEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFIPGPEETSEKVENGSLCDQEIDSICSIERADNDKEYLVLTL ...
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Background:This gene was identified as a tumor suppressor that is mutated in a large number of cancers at high frequency. The protein encoded this gene is a phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase. It contains a tensin like domain as well as a catalytic domain similar to that of the dual specificity protein tyrosine phosphatases. Unlike most of the protein tyrosine phosphatases, this protein preferentially dephosphorylates phosphoinositide substrates. It negatively regulates intracellular levels of phosphatidylinositol-3,4,5-trisphosphate in cells and functions as a tumor suppressor by negatively regulating AKT/PKB signaling pathway.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2a Kappa
Host_Name:Mouse
Buffer:In 1x PBS, pH 7.2
ListPrice:295
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-Bannayan Zonana syndrome antibody, anti-BZS antibody, anti-ITGA 2 antibody, anti-MGC11227 antibody, anti-MHAM antibody, anti-MMAC1 antibody, anti-Multiple hamartoma (Cowden syndrome) antibody, anti-Mutated in Mutiple Advanced Cancers 1 antibody, anti-Phosphatase and Tensin Homolog antibody, anti-Phosphatidylinositol 345 trisphosphate 3 phosphatase antibody, anti-Platelet antigen BR antibody, anti-PTEN1 antibody, anti-TEP1 antibody, anti-VLA 2 Receptor Alpha Subunit antibody
ProteinTarget:phosphatase and tensin homolog (mutated in multiple advanced cancers 1)
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:5728
Gene_Symbol:PTEN
Omim_ID:137800, 153480, 158350, 176807, 176920, 188470, 276950, 601728, 607174,
order or
more information
:
company product webpage
request information:
Also see:
all human PTEN antibodies
anti mouse secondary antibodies


2008©ExactAntigen home | browse | about