| CatalogCode: | H00005728-A01 |
| ProductName: | phosphatase and tensin homolog Antibody |
| Product Description: | Mouse Polyclonal anti-phosphatase and tensin homolog |
| Clonality: | Polyclonal |
| Immunogen: | PTEN (AAH05821, 221 a.a. ~ 320 a.a) partial recombinant protein with GST tag. |
| Epitope: | KVKIYSSNSGPTRREDKFMYFEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFIPGPEETSEKVENGSLCDQEIDSICSIERADNDKEYLVLTL ... |
| Specificity: | phosphatase and tensin homolog (mutated in multiple advanced cancers 1) |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera
Other applications have not been tested. |
| Background: | This gene was identified as a tumor suppressor that is mutated in a large number of cancers at high frequency. The protein encoded this gene is a phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase. It contains a tensin like domain as well as a catalytic domain similar to that of the dual specificity protein tyrosine phosphatases. Unlike most of the protein tyrosine phosphatases, this protein preferentially dephosphorylates phosphoinositide substrates. It negatively regulates intracellular levels of phosphatidylinositol-3,4,5-trisphosphate in cells and functions as a tumor suppressor by negatively regulating AKT/PKB signaling pathway. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-BZS antibody, anti-MGC11227 antibody, anti-MHAM antibody, anti-MMAC1 antibody, anti-PTEN1 antibody, anti-TEP1 antibody |
| ProteinTarget: | phosphatase and tensin homolog (mutated in multiple advanced cancers 1) |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 5728 |
| Gene_Symbol: | PTEN |
| Omim_ID: | 137800, 153480, 158350, 176807, 176920, 188470, 276950, 601728, 607174, |
order or
more information: | company product webpage |
| request information: |
|