| request information: |
|
| Catalog Code: | H00005727-M08 |
| Product Name: | PTCH Antibody |
| Product Description: | Mouse Monoclonal anti-PTCH (3C2) |
| Clone: | 3C2 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 5727 |
| Gene Symbol: | PTCH |
| Omim ID: | 109400, 601309, 605462, |
| Immunogen: | PTCH (NP_000255, 841 a.a. ~ 941 a.a) partial recombinant protein with GST tag. |
| Epitope: | PKMWLHYFRDWLQGLQDAFDSDWETGKIMPNNYKNGSDDGVLAYKLLVQTGSRDKPIDISQLTKQRLVDADGIINPSAF
YIYLTAWVSNDPVAYAASQAN* |
| Specificity: | PTCH - patched homolog (Drosophila) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | This gene encodes a member of the patched gene family. The encoded protein is the receptor for sonic hedgehog, a secreted molecule implicated in the formation of embryonic structures and in tumorigenesis, as well as the desert hedgehog and indian hedgehog proteins. This gene functions as a tumor suppressor. Mutations of this gene have been associated with basal cell nevus syndrome, esophageal squamous cell carcinoma, trichoepitheliomas, transitional cell carcinomas of the bladder, as well as holoprosencephaly. Alternative splicing results in multiple transcript variants encoding different isoforms. Additional splice variants have been described, but their full length sequences and biological validity cannot be determined currently. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-PTCH antibody, anti-patched homolog (Drosophila) antibody, anti-RP11-435O5.3 antibody, anti-BCNS antibody, anti-FLJ42602 antibody, anti-HPE7 antibody, anti-NBCCS antibody, anti-PTC antibody, anti-PTC1 antibody, anti-PTCH1 antibody, anti-PTCH protein +12b antibody, anti-PTCH protein +4' antibody, anti-PTCH protein -10 antibody, anti-patched antibody, anti-patched (Drosophila) homolog antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |
|