| Catalog Code: | H00005723-M06 |
| Product Type: | Primary Antibody |
| Product Name: | PSPH Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 5723 |
| Host: | Mouse |
| Clone: | 3C1 |
| Product Description: | Mouse Monoclonal anti-PSPH (3C1) |
| Species Summary: | Hu |
| Background: | The protein encoded by this gene belongs to a subfamily of the phosphotransferases. This encoded enzyme is responsible for the third and last step in L-serine formation. It catalyzes magnesium-dependent hydrolysis of L-phosphoserine and is also involved i |
| Alternate Names: | anti-PSP antibody, anti-phosphoserine phosphatase antibody |
| Immunogen: | PSPH (NP_004568, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag. |
| Epitope: | MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQE* ... |
| Purity: | protein A purified |
| Buffer: | 1x PBS, pH 7.2 |
| Packaging: | 0.1 mg protein A purified Mouse ascites. |
| Package Size: | 0.1 mg |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | PSPH |
| Omim ID: | 172480, |