ExactAntigen

PSMC3 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00005702-M01
Product Type:Primary Antibody
Product Name:PSMC3 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:5702
Host:Mouse
Clone:1B9
Isotype:IgG1 Kappa
Product Description:Mouse Monoclonal anti-PSMC3 (1B9)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = PSMC3 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.The 26S proteasome
Alternate Names:anti-MGC8487 antibody, anti-TBP1 antibody
Immunogen:PSMC3 (AAH08713, 53 a.a. ~ 152 a.a) partial recombinant protein with GST tag.
Epitope:MNLLPNIESPVTRQEKMATVWDEAEQDGIGEEVLKMSTEEIIQRTRLLDSEIKIMKSEVLRVTHELQAMKDKIKENSEKIKVNKTLPYLVSNVIELLDVD ...
Specificity:PSMC3 - proteasome (prosome, macropain) 26S subunit, ATPase, 3
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Application Summary:ELISA, WB
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:PSMC3
Omim ID:186852
see all human PSMC3 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about