| request information: |
|
| Catalog Code: | H00005686-A01 |
| Product Name: | PSMA5 Antibody |
| Product Description: | Mouse Polyclonal anti-PSMA5 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 5686 |
| Gene Symbol: | PSMA5 |
| Omim ID: | 176844 |
| Immunogen: | PSMA5 (NP_002781, 132 a.a. ~ 242 a.a) partial recombinant protein with GST tag. |
| Epitope: | AMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKL
NATNIELATVQPGQNFHMFTKEELEEVIKDI* |
| Specificity: | PSMA5 - proteasome (prosome, macropain) subunit, alpha type, 5 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-PSC5 antibody, anti-ZETA antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |