| request information: |
|
| Catalog Code: | H00005664-A01 |
| Product Name: | PSEN2 Antibody |
| Product Description: | Mouse Polyclonal anti-PSEN2 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 5664 |
| Gene Symbol: | PSEN2 |
| Omim ID: | 600759 606889 |
| Immunogen: | PSEN2 (NP_000438, 1 a.a. ~ 87 a.a) partial recombinant protein with GST tag. |
| Epitope: | MLTFMASDSEEEVCDERTSLMSAESPTPRSCQEGRQGPEDGENTAQWRSQENEEDGEEDPDRYVCSGVPGRPPGLEEEL
TLKYGAK* |
| Specificity: | PSEN2 - presenilin 2 (Alzheimer disease 4) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | Alzheimer's disease (AD) patients with an inherited form of the disease carry mutations in the presenilin proteins (PSEN1 or PSEN2) or the amyloid precursor protein (APP). These disease-linked mutations result in increased production of the longer form of amyloid-beta (main component of amyloid deposits found in AD brains). Presenilins are postulated to regulate APP processing through their effects on gamma-secretase, an enzyme that cleaves APP. Also, it is thought that the presenilins are involved in the cleavage of the Notch receptor such that, they either directly regulate gamma-secretase activity, or themselves act are protease enzymes. Two alternatively spliced transcript variants encoding different isoforms of PSEN2 have been identified. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-AD3L antibody, anti-AD4 antibody, anti-PS2 antibody, anti-STM2 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |