ExactAntigen

KLK6 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00005653-M01
Product Type:Primary Antibody
Product Name:KLK6 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:5653
Host:Mouse
Clone:4A10
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-KLK6 (4A10)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours.Kallikreins are a subgroup of serine proteases having di
Alternate Names:anti-Bssp antibody, anti-Klk7 antibody, anti-MGC9355 antibody, anti-NEUROSIN antibody, anti-PRSS18 antibody, anti-PRSS9 antibody, anti-SP59 antibody, anti-ZYME antibody, anti-hK6 antibody
Immunogen:KLK6 (AAH15525, 91 a.a. ~ 190 a.a) partial recombinant protein with GST tag.
Epitope:RAVIHPDYDAASHDQDIMLLRLARPAKLSELIQPLPLERDCSANTTSCHILGWGKTADGDFPDTIQCAYIHLVSREECEHAYPGQITQNMLCAGDEKYGK ...
Purity:IgG purified
Buffer:In 1x PBS, pH 7.2
Packaging:100 ug purified IgG
Package Size:100 ug
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:KLK6
Omim ID:602652,
see all human KLK6 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about