| request information: |
|
| Catalog Code: | H00005652-A01 |
| Product Name: | PRSS8 Antibody |
| Product Description: | Mouse Polyclonal anti-PRSS8 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 5652 |
| Gene Symbol: | PRSS8 |
| Omim ID: | 600823, |
| Immunogen: | PRSS8 (NP_002764, 33 a.a. ~ 132 a.a) partial recombinant protein with GST tag. |
| Epitope: | AEAPCGVAPQARITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGAHQLDSYSED
AKVSTLKDIIPHPSYLQEGS* |
| Specificity: | PRSS8 - protease, serine, 8 (prostasin) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml Whole antisera Mouse antisera. |
| Uses: | Antibody reactive against tissue lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | This gene encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is highly expressed in prostate epithelia and is one of several proteolytic enzymes found in seminal fluid. The proprotein is cleaved to produce a light chain and a heavy chain which are associated by a disulfide bond. It is active on peptide linkages involving the carboxyl group of lysine or arginine. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CAP1 antibody, anti-PROSTASIN antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |