| request information: |
|
| Catalog Code: | H00005651-M01 |
| Product Name: | PRSS7 Antibody |
| Product Description: | Mouse Monoclonal anti-PRSS7 (3F8) |
| Clone: | 3F8 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 5651 |
| Gene Symbol: | PRSS7 |
| Immunogen: | PRSS7 (NP_002763, 361 a.a. ~ 471 a.a) partial recombinant protein with GST tag. |
| Epitope: | NDDNEWERIQGSTFSPFTGPNFDHTFGNASGFYISTPTGPGGRQERVGLLSLPLDPTLEPACLSFWYHMYGENVHKLSI
NISNDQNMEKTVFQKEGNYGDNWNYGQVTLN* |
| Specificity: | PRSS7 - protease, serine, 7 (enterokinase) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | This gene encodes an enzyme that converts the pancreatic proenzyme trypsinogen to trypsin, which activates other proenzymes including chymotrypsinogen and procarboxypeptidases. The precursor protein is cleaved into two chains that form a heterodimer linked by a disulfide bond. This protein is a member of the trypsin family of peptidases. Mutations in this gene cause enterokinase deficiency, a malabsorption disorder characterized by diarrhea and failure to thrive. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-ENTK antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |