ExactAntigen

Mouse Polyclonal anti-KLK7 - kallikrein 7 (chymotryptic, stratum corneum) | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00005650-B01
ProductName: KLK7 Antibody
Product Description: Mouse Polyclonal anti-KLK7 - kallikrein 7 (chymotryptic, stratum corneum)
Clone: kallikrein 7 (chymotryptic, stratum corn
Clonality: Polyclonal
Immunogen: KLK7 (AAH32005, 1 a.a. ~ 254 a.a) full-length human protein.
Epitope: MARSLLLPLQILLLSLALETAGEEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR* ...
CrossReactivity: Human. Other species not tested.
Packaging: 0.05 ml of mouse antisera with 50% glycerol.
Uses: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Background: Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Its encoded enzyme is thought to be involved in the proteolysis of intercellular cohesive structures preceding desquamation, which is the shedding of the outermost layer of the epidermis. Alternative splicing of this gene results in two transcript variants encoding the same protein.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Host_Name: Mouse
ListPrice: 295
AppSummary: WB, ELISA
SpeciesSummary: Hu
ALTnames: anti-PRSS6 antibody, anti-SCCE antibody
ProteinTarget: kallikrein 7 (chymotryptic, stratum corneum)
PackageSize: 0.05 ml
NotesMain: This antibody is available only in North America and is supplied by Abnova. Lead time may be 10-14 days. The immunizing protein may also available for this product. Unit cost for the protein is $250 (2 ug), $305 (10 ug), and $445 (25 ug). MaxPab is a registered trademark of Abnova.
Gene_Id: 5650
Gene_Symbol: KLK7
more information: company product webpage
Also see:
see all human KLK7 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about