| CatalogCode: | | H00005650-B01 |
| ProductName: | | KLK7 Antibody |
| Product Description: | | Mouse Polyclonal anti-KLK7 - kallikrein 7 (chymotryptic, stratum corneum) |
| Clone: | | kallikrein 7 (chymotryptic, stratum corn |
| Clonality: | | Polyclonal |
| Immunogen: | | KLK7 (AAH32005, 1 a.a. ~ 254 a.a) full-length human protein. |
| Epitope: | | MARSLLLPLQILLLSLALETAGEEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR* ... |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | | Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Its encoded enzyme is thought to be involved in the proteolysis of intercellular cohesive structures preceding desquamation, which is the shedding of the outermost layer of the epidermis. Alternative splicing of this gene results in two transcript variants encoding the same protein. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host_Name: | | Mouse |
| ListPrice: | | 295 |
| AppSummary: | | WB, ELISA |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-PRSS6 antibody, anti-SCCE antibody |
| ProteinTarget: | | kallikrein 7 (chymotryptic, stratum corneum) |
| PackageSize: | | 0.05 ml |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova. Lead time may be 10-14 days. The immunizing protein may also available for this product. Unit cost for the protein is $250 (2 ug), $305 (10 ug), and $445 (25 ug). MaxPab is a registered trademark of Abnova. |
| Gene_Id: | | 5650 |
| Gene_Symbol: | | KLK7 |
| more information: | | company product webpage |