| request information: |
|
| Catalog Code: | H00005644-A01 |
| Product Name: | PRSS1 Antibody |
| Product Description: | Mouse Polyclonal anti-PRSS1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 5644 |
| Gene Symbol: | PRSS1 |
| Omim ID: | 167800 276000 |
| Immunogen: | PRSS1 (NP_002760, 138 a.a. ~ 248 a.a) partial recombinant protein with GST tag. |
| Epitope: | KCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSW
GDGCAQKNKPGVYTKVYNYVKWIKNTIAANS* |
| Specificity: | PRSS1 - protease, serine, 1 (trypsin 1) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | This gene encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is secreted by the pancreas and cleaved to its active form in the small intestine. It is active on peptide linkages involving the carboxyl group of lysine or arginine. Mutations in this gene are associated with hereditary pancreatitis. This gene and several other trypsinogen genes are localized to the T cell receptor beta locus on chromosome 7. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-TRP1 antibody, anti-TRY1 antibody, anti-TRY4 antibody, anti-TRYP1 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |