ExactAntigen

PRPH Antibody | Novus Biologicals antibody product information
request information:
Catalog Code:H00005630-A01
Product Name:PRPH Antibody
Product Description:Mouse Polyclonal anti-PRPH
Clonality:Polyclonal
ListPrice:225
Gene ID:5630
Gene Symbol:PRPH
Omim ID:105400, 170710,
Immunogen:PRPH (NP_006253, 374 a.a. ~ 471 a.a) partial recombinant protein with GST tag.
Epitope:RHLREYQELLNVKMALDIEIATYRKLLEGEESRISVPVHSFASLNIKTTVPEVEPPQDSHSRKTVLIKTIETRNGEVVT
ESQKEQRSELDKSSAHSY*
Specificity:PRPH - peripherin
Cross Reactivity:Human. Other species not tested.
Packaging:0.05 ml of mouse antisera with 50% glycerol. No preservative.
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera
Background:This gene encodes a cytoskeletal protein found in neurons of the peripheral nervous system. The encoded protein is a type III intermediate filament protein with homology to other cytoskeletal proteins such as desmin, and is a different protein that the peripherin found in photoreceptors. Mutations in this gene have been associated with susceptibility to amyotrophic lateral sclerosis.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:Whole antisera
Host Name:Mouse
Application Summary:ELISA, Western Blot
Species Summary:Hu
Alternate Names:anti-NEF4 antibody
Package Size:0.05 ml
Preservative:No preservative
order or
more information
:
company product webpage
Also see:
all human peripherin antibodies


2008©ExactAntigen home | browse | about