| request information: |
|
| Catalog Code: | H00005629-M06 |
| Product Name: | PROX1 Antibody |
| Product Description: | Mouse Monoclonal anti-PROX1 (4D1) |
| Clone: | 4D1 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 5629 |
| Gene Symbol: | PROX1 |
| Omim ID: | 601546, |
| Immunogen: | PROX1 (NP_002754, 638 a.a. ~ 738 a.a) partial recombinant protein with GST tag. |
| Epitope: | YARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICK
LDSEVPEIFKSPNCLQELLHE* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |