ExactAntigen

prospero-related homeobox 1 Antibody | Novus Biologicals antibody product information
request information:
Catalog Code:H00005629-M05
Product Name:prospero-related homeobox 1 Antibody
Product Description:Mouse Monoclonal anti-prospero-related homeobox 1 (3A2)
Clone:3A2
Clonality:Monoclonal
ListPrice:295
Gene ID:5629
Gene Symbol:PROX1
Omim ID:601546,
Immunogen:PROX1 (NP_002754, 638 a.a. ~ 738 a.a) partial recombinant protein with GST tag.
Epitope:YARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICK
LDSEVPEIFKSPNCLQELLHE*
Specificity:prospero-related homeobox 1
Cross Reactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody reactive against cell lysate and tissue lysate for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2a Kappa
Host Name:Mouse
Buffer:1X PBS pH 7.2
Application Summary:ELISA, Immunohistochemistry-Paraffin, Western Blot
Species Summary:Hu
Package Size:0.1 mg
Preservative:No preservative
order or
more information
:
company product webpage
Also see:
all human PROX1 antibodies


2008©ExactAntigen home | browse | about