| CatalogCode: | H00005612-M01 |
| ProductName: | PRKRIR Antibody |
| Product Description: | Mouse Monoclonal anti-PRKRIR (1C10-1A6) |
| Clone: | 1C10-1A6 |
| Clonality: | Monoclonal |
| Immunogen: | PRKRIR (AAH21992, 1 a.a. ~ 151 a.a) full length recombinant protein with GST tag. |
| Epitope: | MSTIQSETDCYDIIEVLGKGTFGEVAKGWRRSTGEMVAIKILKNDAYRNRIIKNELKLLHCMRGLDPEEAHVIRFLEFFHDALKFYLVFELLEQNLFEFQKENNFAPLPARHIRTVTLQVLTALARLKELAIIHADLKPENIMLVDQTRCPFRVKVIDFGSASIFSEVRYVKEPYIQSRFYRAPEILLGLPFCEKVDVWSLGCVMAELHLGWPLYPGNNEYDQVRYICETQGLPKPHLLHAACKAHHFFKRNPHP ... |
| Specificity: | PRKRIR - protein-kinase, interferon-inducible double stranded RNA dependent inhibitor, repressor of (P58 repressor) |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA |
| SpeciesSummary: | Hu |
| ALTnames: | anti-PRKRIR antibody, anti-protein-kinase antibody, anti-interferon-inducible double stranded RNA dependent inhibitor antibody, anti-repressor of (P58 repressor) antibody, anti-DAP4 antibody, anti-Death Associated Protein 4 antibody, anti-P52rIPK antibody, anti-Inhibitor of protein kinase PKR antibody |
| ProteinTarget: | PRKRIR - protein-kinase, interferon-inducible double stranded RNA dependent inhibitor, repressor of (P58 repressor) |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 5612 |
| Gene_Symbol: | PRKRIR |
| Omim_ID: | 607374 H00005612-B01 |
order or
more information: | company product webpage |
| request information: |
|