ExactAntigen

MAPK4 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00005596-M02
Product Type:Primary Antibody
Product Name:MAPK4 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:5596
Host:Mouse
Clone:2B10
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-MAPK4 (2B10)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 7-10. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours.Mitogen-activated protein kinase 4 is a member of the mitogen
Alternate Names:anti-ERK3 antibody, anti-Erk4 antibody, anti-PRKM4 antibody, anti-p63MAPK antibody
Immunogen:MAPK4 (NP_002738, 42 a.a. ~ 152 a.a) partial recombinant protein with GST tag.
Epitope:ACRKVAVKKIALSDARSMKHALREIKIIRRLDHDNIVKVYEVLGPKGTDLQGELFKFSVAYIVQEYMETDLARLLEQGTLAEEHAKLFMYQLLRGLKYIHSANVLHRDLK* ...
Purity:IgG purified
Buffer:In 1x PBS, pH 7.2
Packaging:100 ug purified IgG
Package Size:100 ug
Uses:Antibody reactive against recombinant protein on ELISA.
Application Summary:ELISA
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:MAPK4
Omim ID:176949,
see all human MAPK4 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about