| CatalogCode: | | H00005596-A01 |
| ProductName: | | MAPK4 Antibody |
| Product Description: | | Mouse Polyclonal anti-MAPK4 |
| Clonality: | | Polyclonal |
| Immunogen: | | MAPK4 (NP_002738, 42 a.a. ~ 152 a.a) partial recombinant protein with GST tag. |
| Epitope: | | ACRKVAVKKIALSDARSMKHALREIKIIRRLDHDNIVKVYEVLGPKGTDLQGELFKFSVAYIVQEYMETDLARLLEQGTLAEEHAKLFMYQLLRGLKYIHSANVLHRDLK* ... |
| Specificity: | | MAPK4 - mitogen-activated protein kinase 4 |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera |
| Background: | | Mitogen-activated protein kinase 4 is a member of the mitogen-activated protein kinase family. Tyrosine kinase growth factor receptors activate mitogen-activated protein kinases which then translocate into the nucleus where it phosphorylates nuclear targets. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | Whole antisera |
| Host_Name: | | Mouse |
| ListPrice: | | 225 |
| AppSummary: | | ELISA, WB |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-ERK3 antibody, anti-Erk4 antibody, anti-PRKM4 antibody, anti-p63MAPK antibody |
| ProteinTarget: | | MAPK4 - mitogen-activated protein kinase 4 |
| PackageSize: | | 0.05 ml |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 5596 |
| Gene_Symbol: | | MAPK4 |
| Omim_ID: | | 176949 H00005596-M02 |
| more information: | | company product webpage |