ExactAntigen

Mouse Monoclonal anti-MAPK3 (1E2)
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00005595-M03
ProductName:MAPK3 Antibody
Product Description:Mouse Monoclonal anti-MAPK3 (1E2)
Clone:1E2
Clonality:Monoclonal
Immunogen:MAPK3 (AAH13992, 279 a.a. ~ 379 a.a) partial recombinant protein with GST tag.
Epitope:NYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERLKELIFQETARFQPGVLEAP ...
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Background:The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act in a signaling cascade that regulates various cellular processes such as proliferation, differentiation, and cell cycle progression in response to a variety of extracellular signals. This kinase is activated by upstream kinases, resulting in its translocation to the nucleus where it phosphorylates nuclear targets. Alternatively spliced transcript variants encoding different protein isoforms have been described.
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2a Kappa
Host_Name:Mouse
Buffer:In 1x PBS, pH 7.2
ListPrice:295
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-ERK1 antibody, anti-P44ERK1 antibody, anti-P44MAPK antibody, anti-PRKM3 antibody
ProteinTarget:MAPK3
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:5595
Gene_Symbol:MAPK3
Omim_ID:601795,
see all human MAPK3 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about