ExactAntigen

MAPK1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00005594-M01
Product Type:Primary Antibody
Product Name:MAPK1 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:5594
Host:Mouse
Clone:1D1
Isotype:IgG1 kappa
Product Description:Mouse Monoclonal anti-MAPK1 (1D1)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = MAPK1 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.The protein encoded
Alternate Names:anti-ERK antibody, anti-ERK2 antibody, anti-ERT1 antibody, anti-MAPK2 antibody, anti-P42MAPK antibody, anti-PRKM1 antibody, anti-PRKM2 antibody, anti-p38 antibody, anti-p40 antibody, anti-p41 antibody, anti-p41mapk antibody
Immunogen:MAPK1 (AAH17832, 261 a.a. ~ 361 a.a) full length recombinant protein with GST tag.
Epitope:RNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS* ...
Specificity:MAPK1 - mitogen-activated protein kinase 1
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. It has also been used in immunohistochemis
Application Summary:ELISA, WB, IHC-P
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:MAPK1
Omim ID:176948
see all human MAPK1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about