| CatalogCode: | H00005594-A01 |
| ProductName: | MAPK1 Antibody |
| Product Description: | Mouse Polyclonal anti-MAPK1 |
| Clonality: | Polyclonal |
| Immunogen: | MAPK1 (AAH17832, 261 a.a. ~ 360 a.a) partial recombinant protein with GST tag. |
| Epitope: | RNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS* ... |
| Specificity: | MAPK1 - mitogen-activated protein kinase 1 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera |
| Background: | The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. The activation of this kinase requires its phosphorylation by upstream kinases. Upon activation, this kinase translocates to the nucleus of the stimulated cells, where it phosphorylates nuclear targets. Two alternatively spliced transcript variants encoding the same protein, but differing in the UTRs, have been reported for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-ERK antibody, anti-ERK2 antibody, anti-ERT1 antibody, anti-MAPK2 antibody, anti-P42MAPK antibody, anti-PRKM1 antibody, anti-PRKM2 antibody, anti-p38 antibody, anti-p40 antibody, anti-p41 antibody, anti-p41mapk antibody |
| ProteinTarget: | MAPK1 - mitogen-activated protein kinase 1 |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 5594 |
| Gene_Symbol: | MAPK1 |
| Omim_ID: | 176948 H00005594-M01 |