ExactAntigen

PRKDC Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00005591-M03
Product Type:Primary Antibody
Product Name:PRKDC Antibody
List Price:275
Clonality:Monoclonal
Gene ID:5591
Host:Mouse
Clone:2A8
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-PRKDC (2A8)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:The PRKDC gene encodes the catalytic subunit of a nuclear DNA-dependent serine/threonine protein kinase (DNA-PK). The second component is the autoimmune antigen Ku (MIM 152690), which is encoded by the G22P1 gene on chromosome 22q. On its own, the catalyt
Alternate Names:anti-DNAPK antibody, anti-DNPK1 antibody, anti-HYRC antibody, anti-HYRC1 antibody, anti-XRCC7 antibody, anti-p350 antibody
Immunogen:PRKDC (NP_008835, 4019 a.a. ~ 4129 a.a) partial recombinant protein with GST tag.
Epitope:KMLKKGGSWIQEINVAEKNWYPRQKICYAKRKLAGANPAVITCDELLLGHEKAPAFRDYVAVARGSKDHNIRAQEPESGLSEETQVKCLMDQATDPNILGRTWEGWEPWM* ...
Purity:IgG purified
Buffer:In 1x PBS, pH 7.2
Packaging:0.1 mg IgG purified Mouse ascites.
Package Size:0.1 mg
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:PRKDC
Omim ID:600899,
see all human PRKDC antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about