| Catalog Code: | H00005591-M03 |
| Product Type: | Primary Antibody |
| Product Name: | PRKDC Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 5591 |
| Host: | Mouse |
| Clone: | 2A8 |
| Isotype: | IgG2a Kappa |
| Product Description: | Mouse Monoclonal anti-PRKDC (2A8) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | The PRKDC gene encodes the catalytic subunit of a nuclear DNA-dependent serine/threonine protein kinase (DNA-PK). The second component is the autoimmune antigen Ku (MIM 152690), which is encoded by the G22P1 gene on chromosome 22q. On its own, the catalyt |
| Alternate Names: | anti-DNAPK antibody, anti-DNPK1 antibody, anti-HYRC antibody, anti-HYRC1 antibody, anti-XRCC7 antibody, anti-p350 antibody |
| Immunogen: | PRKDC (NP_008835, 4019 a.a. ~ 4129 a.a) partial recombinant protein with GST tag. |
| Epitope: | KMLKKGGSWIQEINVAEKNWYPRQKICYAKRKLAGANPAVITCDELLLGHEKAPAFRDYVAVARGSKDHNIRAQEPESGLSEETQVKCLMDQATDPNILGRTWEGWEPWM* ... |
| Purity: | IgG purified |
| Buffer: | In 1x PBS, pH 7.2 |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Package Size: | 0.1 mg |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | PRKDC |
| Omim ID: | 600899, |