| Catalog Code: | H00005584-M04 |
| Product Type: | Primary Antibody |
| Product Name: | PRKCI Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 5584 |
| Host: | Mouse |
| Clone: | 1C10 |
| Isotype: | IgG1 Kappa |
| Product Description: | Mouse Monoclonal anti-PRKCI (1C10) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | This gene encodes a member of the protein kinase C (PKC) family of serine/threonine protein kinases. The PKC family comprises at least eight members, which are differentially expressed and are involved in a wide variety of cellular processes. This protein |
| Alternate Names: | anti-DXS1179E antibody, anti-MGC26534 antibody, anti-PKCI antibody, anti-nPKC-iota antibody |
| Immunogen: | PRKCI (AAH22016, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag. |
| Epitope: | MSHTVAGGGSGDHSHQVRVKAYYRGDIMITHFEPSISFEGLCNEVRDMCSFDNEQLFTMKWIDEEGDPCTVSSQLELEEAFRLYELNKDSELLIHVFPCV* ... |
| Purity: | IgG purified |
| Buffer: | In 1x PBS, pH 7.2 |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Package Size: | 0.1 mg |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | PRKCI |
| Omim ID: | 600539, |