ExactAntigen

Mouse Monoclonal anti-PRKAB2 (2G9) | Novus Biologicals antibody product information
CatalogCode:H00005565-M01
ProductName:PRKAB2 Antibody
Product Description:Mouse Monoclonal anti-PRKAB2 (2G9)
Clone:2G9
Clonality:Monoclonal
Immunogen:PRKAB2 (AAH53610, 1 a.a. ~ 273 a.a) full length recombinant protein with GST tag.
Epitope:MGNTTSDRVSGERHGAKAARSEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRDLSSSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHLYALSIKDSVMVLSA ...
Specificity:PRKAB2 - protein kinase, AMP-activated, beta 2 non-catalytic subunit
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Background:The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. It is highly expressed in skeletal muscle and thus may have tissue-specific roles.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2b kappa
Host_Name:Mouse
ListPrice:295
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-MGC61468 antibody
ProteinTarget:PRKAB2 - protein kinase, AMP-activated, beta 2 non-catalytic subunit
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:5565
Gene_Symbol:PRKAB2
Omim_ID:602741 H00005565-B01
order or
more information
:
company product webpage
request information:
Also see:
all human PRKAB2 antibodies
anti mouse secondary antibodies


2008©ExactAntigen home | browse | about