ExactAntigen

Mouse Monoclonal anti-PRKAA1 (1G4) | Novus Biologicals antibody product information
CatalogCode:H00005562-M01
ProductName:PRKAA1 Antibody
Product Description:Mouse Monoclonal anti-PRKAA1 (1G4)
Clone:1G4
Clonality:Monoclonal
Immunogen:PRKAA1 (AAH12622, 451 a.a. ~ 551 a.a) partial recombinant protein with GST tag.
Epitope:LQLYQVDSRTYLLDFRSIDDEITEAKSGTATPQRSGSVSNYRSCQRSDSDAEAQGKSSEVSLTSSVTSLDSSPVDLTPRPGSHTIEFFEMCANLIKILAQ* ...
Specificity:PRKAA1 - protein kinase, AMP-activated, alpha 1 catalytic subunit
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Background:The protein encoded by this gene belongs to the ser/thr protein kinase family. It is the catalytic subunit of the 5'-prime-AMP-activated protein kinase (AMPK). AMPK is a cellular energy sensor conserved in all eukaryotic cells. The kinase activity of AMPK is activated by the stimuli that increase the cellular AMP/ATP ratio. AMPK regulates the activities of a number of key metabolic enzymes through phosphorylation. It protects cells from stresses that cause ATP depletion by switching off ATP-consuming biosynthetic pathways. Alternatively spliced transcript variants encoding distinct isoforms have been observed.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2a Kappa
Host_Name:Mouse
ListPrice:295
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-AMPK antibody, anti-AMPKa1 antibody, anti-MGC33776 antibody, anti-MGC57364 antibody
ProteinTarget:PRKAA1 - protein kinase, AMP-activated, alpha 1 catalytic subunit
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:5562
Gene_Symbol:PRKAA1
Omim_ID:602739 H00005562-M02
order or
more information
:
company product webpage
request information:
Also see:
all human PRKAA1 antibodies
anti mouse secondary antibodies


2008©ExactAntigen home | browse | about