ExactAntigen

Mouse Polyclonal anti-PRKAA1 - protein kinase, AMP-activated, alpha 1 catalytic subunit, MaxPab Antibody | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00005562-B01
ProductName: PRKAA1 Antibody
Product Description: Mouse Polyclonal anti-PRKAA1 - protein kinase, AMP-activated, alpha 1 catalytic subunit, MaxPab Antibody
Clonality: Polyclonal
Immunogen: PRKAA1 (-, 1 a.a. ~ 574 a.a) full-length human protein.
Epitope: MRRLSSWRKLATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRKSDVPGVVKTGSTKELDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDG ...
CrossReactivity: Human.
Packaging: 0.05 ml of mouse antisera with 50% glycerol.
Uses: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.
Background: The protein encoded by this gene belongs to the ser/thr protein kinase family. It is the catalytic subunit of the 5'-prime-AMP-activated protein kinase (AMPK). AMPK is a cellular energy sensor conserved in all eukaryotic cells. The kinase activity of AMPK is activated by the stimuli that increase the cellular AMP/ATP ratio. AMPK regulates the activities of a number of key metabolic enzymes through phosphorylation. It protects cells from stresses that cause ATP depletion by switching off ATP-consuming biosynthetic pathways. Alternatively spliced transcript variants encoding distinct isoforms have been observed.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Host_Name: Mouse
ListPrice: 295
AppSummary: WB, ELISA
SpeciesSummary: Hu
ALTnames: anti-1 antibody, anti-AMPK antibody, anti-AMPKa1 antibody, anti-MGC33776 antibody, anti-MGC57364 antibody, anti-alpha antibody
ProteinTarget: protein kinase, AMP-activated, alpha 1 catalytic subunit
PackageSize: 0.05 ml
NotesMain: This antibody is available only in North America and is supplied by Abnova. Lead time may be 10-14 days. The immunizing protein may also available for this product. Unit cost for the protein is $250 (2 ug), $305 (10 ug), and $445 (25 ug). MaxPab is a registered trademark of Abnova.
Gene_Id: 5562
Gene_Symbol: PRKAA1
more information: company product webpage
Also see:
see all human PRKAA1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about