ExactAntigen

PPBP Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00005473-M01
Product Type:Primary Antibody
Product Name:PPBP Antibody
List Price:275
Clonality:Monoclonal
Gene ID:5473
Host:Mouse
Clone:3B9
Isotype:IgG2b Kappa
Product Description:Mouse Monoclonal anti-PPBP (3B9)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = PPBP PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.The protein encoded
Alternate Names:anti-B-TG1 antibody, anti-Beta-TG antibody, anti-CTAP3 antibody, anti-CTAPIII antibody, anti-CXCL7 antibody, anti-LA-PF4 antibody, anti-LDGF antibody, anti-MDGF antibody, anti-NAP-2 antibody, anti-NAP-2-L1 antibody, anti-PBP antibody, anti-SCYB7 antibody,
Immunogen:PPBP (AAH28217, 37 a.a. ~ 128 a.a) partial recombinant protein with GST tag.
Epitope:TKGQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD ...
Specificity:PPBP - pro-platelet basic protein (chemokine (C-X-C motif) ligand 7)
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:PPBP
Omim ID:121010
see all human PPBP antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about