| CatalogCode: | H00005469-M03 |
| ProductName: | PPARBP Antibody |
| Product Description: | Mouse Monoclonal anti-PPARBP (1G4) |
| Clone: | 1G4 |
| Clonality: | Monoclonal |
| Immunogen: | PPARBP (NP_004765, 1391 a.a. ~ 1491 a.a) partial recombinant protein with GST tag. |
| Epitope: | KIIISKHDGGSPSIKAKVTLQKPGESSGEGLRPQMASSKNYGSPLISGSTPKHERGSPSHSKSPAYTPQNLDSESESGSSIAEKSYQNSPSSDDGIRPLP* ... |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. It also regulates p53-dependent apoptosis and it is essential for adipogenesis. This protein is known to have the ability to self-oligomerize. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host_Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-CRSP1 antibody, anti-CRSP200 antibody, anti-DRIP205 antibody, anti-DRIP230 antibody, anti-MED1 antibody, anti-MGC71488 antibody, anti-PBP antibody, anti-PPARGBP antibody, anti-RB18A antibody, anti-TRAP220 antibody, anti-TRIP2 antibody |
| ProteinTarget: | PPAR binding protein |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 5469 |
| Gene_Symbol: | PPARBP |
| Omim_ID: | 604311, |
order or
more information: | company product webpage |
| request information: |
|