| Catalog Code: | H00005469-M02 |
| Product Type: | Primary Antibody |
| Product Name: | PPARBP Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 5469 |
| Host: | Mouse |
| Clone: | 1G3 |
| Isotype: | IgG1 Kappa |
| Product Description: | Mouse Monoclonal anti-PPARBP (1G3) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours.The activation of gene transcription is a multistep proc |
| Alternate Names: | anti-CRSP1 antibody, anti-CRSP200 antibody, anti-DRIP205 antibody, anti-DRIP230 antibody, anti-MED1 antibody, anti-MGC71488 antibody, anti-PBP antibody, anti-PPARGBP antibody, anti-RB18A antibody, anti-TRAP220 antibody, anti-TRIP2 antibody |
| Immunogen: | PPARBP (NP_004765, 1391 a.a. ~ 1491 a.a) partial recombinant protein with GST tag. |
| Epitope: | KIIISKHDGGSPSIKAKVTLQKPGESSGEGLRPQMASSKNYGSPLISGSTPKHERGSPSHSKSPAYTPQNLDSESESGSSIAEKSYQNSPSSDDGIRPLP* ... |
| Purity: | IgG purified |
| Buffer: | In 1x PBS, pH 7.2 |
| Packaging: | 100 ug purified IgG |
| Package Size: | 100 ug |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | PPARBP |
| Omim ID: | 604311, |
|