| CatalogCode: | | H00005464-A01 |
| ProductName: | | PPA1 Antibody |
| Product Description: | | Mouse Polyclonal anti-PPA1 |
| Clonality: | | Polyclonal |
| Immunogen: | | PP (NP_066952, 10 a.a. ~ 112 a.a) partial recombinant protein with GST tag. |
| Epitope: | | AAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHNDKHT* ... |
| Specificity: | | PPA1 - pyrophosphatase (inorganic) |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera |
| Background: | | The protein encoded by this gene is a member of the inorganic pyrophosphatase (PPase) family. PPases catalyze the hydrolysis of pyrophosphate to inorganic phosphate, which is important for the phosphate metabolism of cells. Studies of a similar protein in bovine suggested a cytoplasmic localization of this enzyme. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | Whole antisera |
| Host_Name: | | Mouse |
| ListPrice: | | 225 |
| AppSummary: | | ELISA, WB |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-IOPPP antibody, anti-MGC111556 antibody, anti-PP antibody, anti-PP1 antibody, anti-SID6-8061 antibody |
| ProteinTarget: | | PPA1 - pyrophosphatase (inorganic) |
| PackageSize: | | 0.05 ml |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 5464 |
| Gene_Symbol: | | PPA1 |
| Omim_ID: | | 179030 H00005464-M01 |
| more information: | | company product webpage |