| CatalogCode: | | H00005319-M01 |
| ProductName: | | PLA2G1B Antibody |
| Product Description: | | Mouse Monoclonal anti-PLA2G1B (1B3) |
| Clone: | | 1B3 |
| Clonality: | | Monoclonal |
| Immunogen: | | PLA2G1B (AAH05386, 17 a.a. ~ 71 a.a) full length recombinant protein with GST tag. |
| Epitope: | | SGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKQKQRV* ... |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.1 mg IgG purified Mouse ascites. |
| Uses: | | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | | Phospholipase A2 (EC 3.1.1.4) catalyzes the release of fatty acids from glycero-3-phosphocholines. The best known varieties are the digestive enzymes secreted as zymogens by the pancreas of mammals. Sequences of pancreatic PLA2 enzymes from a variety of mammals have been reported. One striking feature of these enzymes is their close homology to venom phospholipases of snakes. Other forms of PLA2 have been isolated from brain, liver, lung, spleen, intestine, macrophages, leukocytes, erythrocytes, inflammatory exudates, chondrocytes, and platelets (Seilhamer et al., 1986 [PubMed 3028739]) .[supplied by OMIM] |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | IgG purified |
| Isotype: | | IgG2a Kappa |
| Host_Name: | | Mouse |
| Buffer: | | In 1x PBS, pH 7.2 |
| ListPrice: | | 295 |
| AppSummary: | | ELISA, WB |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-MGC119834 antibody, anti-MGC119835 antibody, anti-PLA2 antibody, anti-PLA2A antibody, anti-PPLA2 antibody |
| ProteinTarget: | | phospholipase A2, group IB (pancreas) |
| PackageSize: | | 0.1 mg |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 5319 |
| Gene_Symbol: | | PLA2G1B |
| Omim_ID: | | 172410, |
| more information: | | company product webpage |