| CatalogCode: | H00005305-M01 |
| ProductName: | PIP5K2A Antibody |
| Product Description: | Mouse Monoclonal anti-PIP5K2A (3A3) |
| Clone: | 3A3 |
| Clonality: | Monoclonal |
| Immunogen: | PIP5K2A (NP_005019, 304 a.a. ~ 366 a.a) partial recombinant protein with GST tag. |
| Epitope: | SDGTHPVGTPPDSPGNTLNSSPPLAPGEFDPNIDVYGIKCHENSPRKEVYFMAIIDILTHYD* ... |
| Specificity: | PIP5K2A - phosphatidylinositol-4-phosphate 5-kinase, type II, alpha |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. |
| Background: | Phosphatidylinositol-5,4-bisphosphate, the precursor to second messengers of the phosphoinositide signal transduction pathways, is thought to be involved in the regulation of secretion, cell proliferation, differentiation, and motility. The protein encoded by this gene is one of a family of enzymes capable of catalyzing the phosphorylation of phosphatidylinositol-5-phosphate on the fourth hydroxyl of the myo-inositol ring to form phosphatidylinositol-5,4-bisphosphate. The amino acid sequence of this enzyme does not show homology to other kinases, but the recombinant protein does exhibit kinase activity. This gene is a member of the phosphatidylinositol-5-phosphate 4-kinase family. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-1-phosphatidylinositol-4-phosphate-5-kinase isoform C antibody, anti-Phosphatidylinositol-4-phosphate 5-kinase type II alpha antibody, anti-PIP5KII-alpha antibody, anti-PtdIns(4)P-5-kinase B isoform antibody, anti-type II phosphatidylinositol-4-phosphate 5-kinase 53 K isoform antibody |
| ProteinTarget: | PIP5K2A - phosphatidylinositol-4-phosphate 5-kinase, type II, alpha |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 5305 |
| Gene_Symbol: | PIP5K2A |
| Omim_ID: | 603140, |
order or
more information: | company product webpage |
| request information: |
|