| CatalogCode: | H00005300-M02 |
| ProductName: | PIN1 Antibody |
| Product Description: | Mouse Monoclonal anti-PIN1 (5A8) |
| Clone: | 5A8 |
| Clonality: | Monoclonal |
| Immunogen: | PIN1 (AAH02899, 64 a.a. ~ 163 a.a) partial recombinant protein with GST tag. |
| Epitope: | HSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE ... |
| Specificity: | PIN1 - protein (peptidyl-prolyl cis/trans isomerase) NIMA-interacting 1 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | The human PIN1 gene encodes an essential nuclear peptidylprolyl cis-trans isomerase (PPIase; EC 5.2.1.8) involved in regulation of mitosis. PIN1 belongs to a class of PPIases that includes the E. coli parvulin, yeast Ess1, and Drosophila dodo (dod) gene products (Lu et al., 1996 [PubMed 8606777]).[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-PIN1 antibody, anti-protein (peptidylprolyl cis/trans isomerase) NIMA-interacting 1 antibody, anti-DOD antibody, anti-UBL5 antibody, anti-peptidyl-prolyl cis/trans isomerase antibody, anti-NIMA-interacting antibody, anti-prolyl isomerase antibody, anti-protein (peptidyl-prolyl cis/trans isomerase) NIMA-interacting 1 antibody |
| ProteinTarget: | PIN1 - protein (peptidyl-prolyl cis/trans isomerase) NIMA-interacting 1 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 5300 |
| Gene_Symbol: | PIN1 |
| Omim_ID: | 601052 NB100-53805 |
order or
more information: | company product webpage |
| request information: |
|