ExactAntigen

Mouse Monoclonal anti-PIK3R1 (3A10)
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00005295-M01
ProductName:PIK3R1 Antibody
Product Description:Mouse Monoclonal anti-PIK3R1 (3A10)
Clone:3A10
Clonality:Monoclonal
Immunogen:PIK3R1 (AAH30815, 1 a.a. ~ 455 a.a) full length recombinant protein with GST tag.
Epitope:MYNTVWNMEDLDLEYAKTDINCGTDLMFYIEMDPPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQDQVVKEDNIEAVGKKLHKYNTQFQEKSREYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIM ...
Specificity:PIK3R1 - phosphoinositide-3-kinase, regulatory subunit 1 (p85 alpha)
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Background:Phosphatidylinositol 3-kinase phosphorylates the inositol ring of phosphatidylinositol at the 3-prime position. The enzyme comprises a 110 kD catalytic subunit and a regulatory subunit of either 85, 55, or 50 kD. This gene encodes the 85 kD regulatory subunit. Phosphatidylinositol 3-kinase plays an important role in the metabolic actions of insulin, and a mutation in this gene has been associated with insulin resistance. Alternative splicing of this gene results in three transcript variants encoding different isoforms.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG1 Kappa
Host_Name:Mouse
ListPrice:295
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-GRB1 antibody, anti-p85-ALPHA antibody
ProteinTarget:PIK3R1 - phosphoinositide-3-kinase, regulatory subunit 1 (p85 alpha)
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:5295
Gene_Symbol:PIK3R1
Omim_ID:171833,
see all human PIK3R1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about