ExactAntigen

PIM1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00005292-M08
Product Type:Primary Antibody
Product Name:PIM1 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:5292
Host:Mouse
Clone:1C10
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-PIM1 (1C10)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = PIM1 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours. The protooncogen
Alternate Names:anti-PIM antibody, anti-PIM1 antibody, anti-PIM-1 antibody, anti-Proviral Integration Site 1 antibody
Immunogen:PIM1 (AAH20224, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Epitope:MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGF ...
Specificity:PIM1 - pim-1 oncogene
Purity:IgG purified
Packaging:0.1 ml IgG purified Mouse ascites.
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:PIM1
Omim ID:164960,
see all human PIM1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about