ExactAntigen

Mouse Monoclonal anti-PIK3C2G (3D8) | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00005288-M01
ProductName: PIK3C2G Antibody
Product Description: Mouse Monoclonal anti-PIK3C2G (3D8)
Clone: 3D8
Clonality: Monoclonal
Immunogen: PIK3C2G (NP_004561, 2 a.a. ~ 101 a.a) partial recombinant protein with GST tag.
Epitope: AYSWQTDPNPNESHEKQYEHQEFLFVNQPHSSSQVSLGFDQIVDEISGKIPHYESEIDENTFFVPTAPKWDSTGHSLNEAHQISLNEFTSKSRELSWHQ* ...
CrossReactivity: Human. Other species not tested.
Packaging: 0.1 mg IgG purified Mouse ascites.
Uses: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Background: The protein encoded by this gene belongs to the phosphoinositide 3-kinase (PI3K) family. PI3-kinases play roles in signaling pathways involved in cell proliferation, oncogenic transformation, cell survival, cell migration, and intracellular protein trafficking. This protein contains a lipid kinase catalytic domain as well as a C-terminal C2 domain, a characteristic of class II PI3-kinases. C2 domains act as calcium-dependent phospholipid binding motifs that mediate translocation of proteins to membranes, and may also mediate protein-protein interactions. The biological function of this gene has not yet been determined.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity: IgG purified
Isotype: IgG1 Kappa
Host_Name: Mouse
Buffer: In 1x PBS, pH 7.2
ListPrice: 295
AppSummary: ELISA, WB
SpeciesSummary: Hu
ALTnames: anti-PI3K-C2 GAMMA antibody
ProteinTarget: phosphoinositide-3-kinase, class 2, gamma polypeptide
PackageSize: 0.1 mg
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 5288
Gene_Symbol: PIK3C2G
Omim_ID: 609001,
more information: company product webpage
Also see:
see all human PIK3C2G antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about