ExactAntigen

Mouse Monoclonal anti-PHB (3F4-2B2)
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00005245-M01
ProductName:PHB Antibody
Product Description:Mouse Monoclonal anti-PHB (3F4-2B2)
Clone:3F4-2B2
Clonality:Monoclonal
Immunogen:PHB (AAH13401, 1 a.a. ~ 273 a.a) full length recombinant protein with GST tag.
Epitope:MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSR ...
Specificity:PHB - prohibitin
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. It has also been used in immunofluorescence and immunohistochemistry on paraffin-embedded sections.
Background:Prohibitin is an evolutionarily conserved gene that is ubiquitously expressed. It is thought to be a negative regulator of cell proliferation and may be a tumor suppressor. Mutations in PHB have been linked to sporadic breast cancer. Prohibitin is expressed as two transcripts with varying lengths of 3' untranslated region. The longer transcript is present at higher levels in proliferating tissues and cells, suggesting that this longer 3' untranslated region may function as a trans-acting regulatory RNA.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2a kappa
Host_Name:Mouse
ListPrice:295
AppSummary:ELISA, WB, IHC-P, IF
SpeciesSummary:Hu
ProteinTarget:PHB - prohibitin
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:5245
Gene_Symbol:PHB
Omim_ID:176705 H00080012-B01
see all human prohibitin antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about