ExactAntigen

PGAM1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00005223-M01
Product Type:Primary Antibody
Product Name:PGAM1 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:5223
Host:Mouse
Clone:2G1-A6
Isotype:IgG1 kappa
Product Description:Mouse Monoclonal anti-PGAM1 (2G1-A6)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = PGAM1 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.
Alternate Names:anti-PGAM1 antibody, anti-phosphoglycerate mutase 1 (brain) antibody, anti-PGAMA antibody, anti-RP11-452K12.8 antibody, anti-OTTHUMP00000059414 antibody, anti-Phosphoglycerate mutase A antibody, anti-nonmuscle form antibody, anti-PGAM2 antibody, anti-phos
Immunogen:PGAM1 (AAH11678, 1 a.a. ~ 255 a.a) full length recombinant protein with GST tag.
Epitope:MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKK* ...
Specificity:PGAM1 - phosphoglycerate mutase 1 (brain)
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA. The antibody is also shown to be specific in Western blot against cell lysates.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:PGAM1
Omim ID:172250,
see all human PGAM1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about