ExactAntigen

PDK4 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00005166-A01
Product Type:Primary Antibody
Product Name:PDK4 Antibody
List Price:205
Clonality:Polyclonal
Gene ID:5166
Host:Mouse
Product Description:Mouse Polyclonal anti-PDK4
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:This gene is a member of the PDK/BCKDK protein kinase family and encodes a mitochondrial protein with a histidine kinase domain. This protein is located in the matrix of the mitrochondria and inhibits the pyruvate dehydrogenase complex by phosphorylating
Immunogen:PDK4 (AAH40239, 181 a.a. ~ 280 a.a) partial recombinant protein with GST tag.
Epitope:SDSQTGNPSHIGSIDPNCDVVAVVQDAFECSRMLCDQYYLSSPELKLTQVNGKFPDQPIHIVYVPSHLHHMLFELFKNAMRATVEHQENQPSLTPIEVIV ...
Specificity:PDK4 - pyruvate dehydrogenase kinase, isoenzyme 4
Purity:Whole antisera
Packaging:50 ul of mouse antisera with 50% glycerol. No preservative.
Package Size:50 ul
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein. Abnova's recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:PDK4
Omim ID:602527
see all human PDK4 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about