ExactAntigen

PDK1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00005163-M02
Product Type:Primary Antibody
Product Name:PDK1 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:5163
Host:Mouse
Clone:30
Isotype:IgG1 Kappa
Product Description:Mouse Monoclonal anti-PDK1 (30)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = PDK1 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.Pyruvate dehydrogena
Alternate Names:anti-PDK1 antibody, anti-pyruvate dehydrogenase kinase antibody, anti-isoenzyme 1antibody, anti-HGNC:8809 antibody, anti-mitochondrial pyruvate dehydrogenase kinase isoenzyme 1 antibody, anti-pyruvate dehydrogenase kinase antibody, anti-isoenzyme 1 antibo
Immunogen:PDK1 (AAH39158, 203 a.a. ~ 302 a.a) partial recombinant protein with GST tag.
Epitope:GGKGKGSPSHRKHIGSINPNCNVLEVIKDGYENARRLCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPPIQ ...
Specificity:PDK1 - pyruvate dehydrogenase kinase, isozyme 1
Purity:IgG purified
Packaging:0.1 ml IgG purified Mouse ascites.
Package Size:0.1 ml
Uses:Antibody reactive against recombinant protein on ELISA.
Application Summary:ELISA
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:PDK1
Omim ID:602524,
see all human PDK1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about