| Catalog Code: | H00005163-M01 |
| Product Type: | Primary Antibody |
| Product Name: | PDK1 Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 5163 |
| Host: | Mouse |
| Clone: | 3B7 |
| Isotype: | IgG2b kappa |
| Product Description: | Mouse Monoclonal anti-PDK1 (3B7) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | NCBI Entrez Gene ID = PDK1 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.Pyruvate dehydrogena |
| Alternate Names: | anti-PDK1 antibody, anti-pyruvate dehydrogenase kinase antibody, anti-isoenzyme 1antibody, anti-HGNC:8809 antibody, anti-mitochondrial pyruvate dehydrogenase kinase isoenzyme 1 antibody, anti-pyruvate dehydrogenase kinase antibody, anti-isoenzyme 1 antibo |
| Immunogen: | PDK1 (AAH39158, 203 a.a. ~ 302 a.a) partial recombinant protein with GST tag. |
| Epitope: | GGKGKGSPSHRKHIGSINPNCNVLEVIKDGYENARRLCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPPIQ ... |
| Specificity: | PDK1 - pyruvate dehydrogenase kinase, isoenzyme 1 |
| Purity: | IgG purified |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Package Size: | 0.1 mg |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Application Summary: | ELISA |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | PDK1 |
| Omim ID: | 602524 |