| CatalogCode: | | H00005156-M01 |
| ProductName: | | PDGFRA Antibody |
| Product Description: | | Mouse Monoclonal anti-PDGFRA (2D2-1A11) |
| Clone: | | 2D2-1A11 |
| Clonality: | | Monoclonal |
| Immunogen: | | PDGFRA (AAH15186, 25 a.a. ~ 219 a.a) full length recombinant protein with GST tag. |
| Epitope: | | LSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYPMSEEESSDVEIRNEENNSGLFVTVLEVSSASAAHTGLYTCYYNHTQTEENELEGRHIYIYVPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLHNSEGVVPASYDSRQGFNGTFTVGPYICEATVKGKKFQTIPFNVYALKGTCIISFLL* ... |
| Specificity: | | PDGFRA - platelet-derived growth factor receptor, alpha polypeptide |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.1 mg IgG purified Mouse ascites. |
| Uses: | | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | | This gene encodes a cell surface tyrosine kinase receptor for members of the platelet-derived growth factor family. These growth factors are mitogens for cells of mesenchymal origin. The identity of the growth factor bound to a receptor monomer determines whether the functional receptor is a homodimer or a heterodimer, composed of both platelet-derived growth factor receptor alpha and beta polypeptides. Studies in knockout mice, where homozygosity is lethal, indicate that the alpha form of the platelet-derived growth factor receptor is particularly important for kidney development since mice heterozygous for the receptor exhibit defective kidney phenotypes. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | IgG purified |
| Isotype: | | IgG1 kappa |
| Host_Name: | | Mouse |
| ListPrice: | | 295 |
| AppSummary: | | ELISA, WB |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-CD140A antibody, anti-MGC74795 antibody, anti-PDGFR2 antibody |
| ProteinTarget: | | PDGFRA - platelet-derived growth factor receptor, alpha polypeptide |
| PackageSize: | | 0.1 mg |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 5156 |
| Gene_Symbol: | | PDGFRA |
| Omim_ID: | | 173,490,606,764,607,000 PAB0570 |
| more information: | | company product webpage |