ExactAntigen

Mouse Monoclonal anti-PCTK1 (2E5) | Novus Biologicals antibody product information
CatalogCode:H00005127-M02
ProductName:PCTK1 Antibody
Product Description:Mouse Monoclonal anti-PCTK1 (2E5)
Clone:2E5
Clonality:Monoclonal
Immunogen:PCTK1 (AAH01048, 1 a.a. ~ 80 a.a) partial recombinant protein with GST tag.
Epitope:MDRMKKIKRQLSMTLRGGRGIDKTNGAPEQIGLDESGGGGGSDPGEAPTRAAPGELRSARGPLSSAPEIVHEDLKMGSDG ...
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Background:The protein encoded by this gene belongs to the cdc2/cdkx subfamily of the ser/thr family of protein kinases. It may play a role in signal transduction cascades in terminally differentiated cells. This gene is thought to escape X inactivation. Two transcript variants encoding the same protein have been found for this gene.
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2a Kappa
Host_Name:Mouse
Buffer:In 1x PBS, pH 7.2
ListPrice:295
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-FLJ16665 antibody, anti-PCTAIRE antibody, anti-PCTAIRE1 antibody, anti-PCTGAIRE antibody
ProteinTarget:PCTK1
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:5127
Gene_Symbol:PCTK1
Omim_ID:311550,
order or
more information
:
company product webpage
request information:
Also see:
all human PCTK1 antibodies
anti mouse secondary antibodies


2008©ExactAntigen home | browse | about